PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_18209_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family bZIP
Protein Properties Length: 211aa    MW: 24227.6 Da    PI: 8.7911
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_18209_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.22.7e-1196148557
                                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                                bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                                           ++ rr+++NRe+ArrsR RK++ +e+L++ v  L   N++L ++l   + ++ 
  cra_locus_18209_iso_1_len_1661_ver_3  96 RKRRRMISNRESARRSRMRKQKHLENLRNQVNRLRVGNRELMNRLRFVTHHCN 148
                                           5789*************************************999987777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.7E-1087149No hitNo description
SMARTSM003381.3E-1392156IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.42794157IPR004827Basic-leucine zipper domain
PfamPF001706.6E-996149IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.9E-1196147No hitNo description
CDDcd147021.11E-1897148No hitNo description
PROSITE patternPS00036099114IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MISSDGLFGS PFPAFETGFT PWDYPDPPFE SETIHFPSLE QQQEPVNSNS GSDNSNSNAN  60
PIPVDSNSGS DEPNGKNNKN SSSGSPGDSS SLIDERKRRR MISNRESARR SRMRKQKHLE  120
NLRNQVNRLR VGNRELMNRL RFVTHHCNLI RNDNDRLRSE SVVLRQRLWD IRQVLHVREL  180
HQQQLASSSS VWPCNNFNFN DQETIPQSLI T
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19599RKRRR
295116RKRRRMISNRESARRSRMRKQK
3108115RRSRMRKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006426133.16e-67hypothetical protein CICLE_v10027584mg
TrEMBLA0A068U4U61e-75A0A068U4U6_COFCA; Uncharacterized protein
STRINGVIT_00s0541g00020.t017e-63(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28202251